Recombinant Human Glutathione S-transferase kappa 1 (GSTK1) (Active)
Recombinant Human Glutathione S-transferase kappa 1 (GSTK1) (Active)
Product Specifications
Product Name Alternative
GST 13-13 GST class-kappa GSTK1-1
UniProt
Q9Y2Q3
Tag
N-terminal GST-tagged
Field of Research
Pharmacology & Drug Discovery
Purity
Greater than 90% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 g, ml can bind human GSTK1, the EC50 of human GSTK1 protein is 159.40-218.50 ng, ml.
Form
Tris-based buffer, 50% glycerol
Molecular Weight
52.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
AA Sequence
GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941223-500 1x 500 µL
Chromogranin A (LK2H10 + PHE5 + CGA414), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC051429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942099-500 1x 500 µL
Catenin, beta (p120) (CTNNB1/2099), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881920-500 1x 500 µL
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details