Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2) (Active)
Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2) (Active)
Product Specifications
UniProt
Q9Y6E2
Tag
N-terminal GST-tagged
Field of Research
Neuroscience; Pharmacology & Drug Discovery
Purity
Greater than 90% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 g, ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 g, ml.
Form
Tris-based buffer, 50% glycerol
Molecular Weight
75.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
AA Sequence
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC424451 20 µg
Pancreatic Lipase (PNLIP) (NM_000936) Human Over-expression Lysate
Sign In for Pricing
View Details 
E-AB-FC0003-01 20 Tests
Anti-Human CD3-FITC/CD4-PE/CD45-PerCP-Cyanine5.5 Cocktail
Sign In for Pricing
View Details