Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8

This Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8 spans the amino acid sequence from region 2-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LZ-8)

UniProt

P14945

Expression Region

2-111aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ganoderma lucidum (Ling zhi medicinal fungus) (Bracket fungus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SUS6 Polyclonal Antibody
MBS7144477 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SUS6 Polyclonal Antibody

Sign In for Pricing
View Details
17β-HSD5 inhibitor 2
T211300-01 10 mg

17β-HSD5 inhibitor 2

Sign In for Pricing
View Details
17β-HSD5 inhibitor 2
T211300-02 50 mg

17β-HSD5 inhibitor 2

Sign In for Pricing
View Details
Lentiviral mouse Ccdc136 shRNA (UAS) - Lentiviral mouseCcdc136 shRNA (UAS, GFP) (25)
GTR15140240 1 Vial

Lentiviral mouse Ccdc136 shRNA (UAS) - Lentiviral mouseCcdc136 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit Cysteine protease ATG4A (ATG4A) ELISA Kit
GTR10363666 96 Well

Rabbit Cysteine protease ATG4A (ATG4A) ELISA Kit

Sign In for Pricing
View Details
Mouse Mtch2 activation kit by CRISPRa
GA205963 1 Kit

Mouse Mtch2 activation kit by CRISPRa

Sign In for Pricing
View Details