Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8

This Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8 spans the amino acid sequence from region 2-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LZ-8)

UniProt

P14945

Expression Region

2-111aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ganoderma lucidum (Ling zhi medicinal fungus) (Bracket fungus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYL4 Antibody
orb1260515 100 µL

MYL4 Antibody

Sign In for Pricing
View Details
SIR4 Antibody
C46278-01 50 μL

SIR4 Antibody

Sign In for Pricing
View Details
SIR4 Antibody
C46278-02 100 µL

SIR4 Antibody

Sign In for Pricing
View Details
CACNA1C (pS1927) Antibody
abx148791 100 µg

CACNA1C (pS1927) Antibody

Sign In for Pricing
View Details
Sheep A-kinase anchor protein 3 (AKAP3) ELISA Kit
MBS7252675-01 48 Well

Sheep A-kinase anchor protein 3 (AKAP3) ELISA Kit

Sign In for Pricing
View Details
Sheep A-kinase anchor protein 3 (AKAP3) ELISA Kit
MBS7252675-02 96 Well

Sheep A-kinase anchor protein 3 (AKAP3) ELISA Kit

Sign In for Pricing
View Details