Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8

This Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8 spans the amino acid sequence from region 2-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LZ-8)

UniProt

P14945

Expression Region

2-111aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ganoderma lucidum (Ling zhi medicinal fungus) (Bracket fungus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit
orb1807324-01 48 Tests

Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit

Sign In for Pricing
View Details
Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit
orb1807324-02 96 Tests

Human Myeloid Differentiation Factor 88 (MyD88) ELISA Kit

Sign In for Pricing
View Details
Ltv1 (NM_181470) Mouse Tagged ORF Clone Lentiviral Particle
MR207522L3V 200 µL

Ltv1 (NM_181470) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sufu Mouse Pre-designed siRNA Set A
HY-RS18155 1 Set

Sufu Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
anti-delta 1 Catenin
YF-PA11185 100 ug

anti-delta 1 Catenin

Sign In for Pricing
View Details
NU227326
T205704-01 10 mg

NU227326

Sign In for Pricing
View Details