Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-12 (RAB12)

This Recombinant Human Ras-related protein Rab-12 (RAB12) spans the amino acid sequence from region 1-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6IQ22

Expression Region

1-244aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDST2 Protein Lysate (Human) with C-Ha Tag
31608031 100 µg

NDST2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
FRS2 (NM_001042555) Human Tagged Lenti ORF Clone
RC214628L3 10 µg

FRS2 (NM_001042555) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Monoclonal Poly-Ubiquitin Antibody (Genentech patent anti-Polyubiquitin) [Janelia Fluor 669]
NBP3-27986JF669 0.1 mL

Human Monoclonal Poly-Ubiquitin Antibody (Genentech patent anti-Polyubiquitin) [Janelia Fluor 669]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) murP Polyclonal Antibody
MBS9002745 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) murP Polyclonal Antibody

Sign In for Pricing
View Details
Rat Neurocan (NCAN) ELISA kit
201-11-1428 96 Tests

Rat Neurocan (NCAN) ELISA kit

Sign In for Pricing
View Details
Cytochrome P450 7A1 (CYP7A1) Monkey ELISA Kit
C7118 96 Tests

Cytochrome P450 7A1 (CYP7A1) Monkey ELISA Kit

Sign In for Pricing
View Details