Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-12 (RAB12)

This Recombinant Human Ras-related protein Rab-12 (RAB12) spans the amino acid sequence from region 1-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6IQ22

Expression Region

1-244aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC7, CT (Histone Deacetylase 7, HD7, Histone Deacetylase 7A, HD7a, HDAC7A) (PE) discontinued
H1827-56D3-PE 200 µL

HDAC7, CT (Histone Deacetylase 7, HD7, Histone Deacetylase 7A, HD7a, HDAC7A) (PE) discontinued

Sign In for Pricing
View Details
Krt72-ps sgRNA CRISPR Lentivector set (Mouse)
K3463701 3x 1.0 µg

Krt72-ps sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
LYVE1 Rabbit pAb
E45R26544N 50 ul

LYVE1 Rabbit pAb

Sign In for Pricing
View Details
4-Amino-D,L-benzylsuccinic Acid
TRC-A601500-25MG 25 mg

4-Amino-D,L-benzylsuccinic Acid

Sign In for Pricing
View Details
CD160 Polyclonal Antibody, HRP Conjugated
A50110-050 50 µL

CD160 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
PGR, CT (PGR, NR3C3, Progesterone receptor, Nuclear receptor subfamily 3 group C member 3) (Azide free) (HRP) discontinued
039928-HRP 200 µL

PGR, CT (PGR, NR3C3, Progesterone receptor, Nuclear receptor subfamily 3 group C member 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details