Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Trefoil factor 3 (TFF3)

This Recombinant Dog Trefoil factor 3 (TFF3) spans the amino acid sequence from region 24-80aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Intestinal trefoil factor)

UniProt

Q863B4

Expression Region

24-80aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep cytovillin/ezrin ELISA Kit
GTR10458526 96 Well

Sheep cytovillin/ezrin ELISA Kit

Sign In for Pricing
View Details
SHISA9 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-11950R-BF350 100 µL

SHISA9 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
RPGR1 rabbit pAb
RA34580-01 50 µL

RPGR1 rabbit pAb

Sign In for Pricing
View Details
RPGR1 rabbit pAb
RA34580-02 100 µL

RPGR1 rabbit pAb

Sign In for Pricing
View Details
Kcnab2 Mouse qPCR Primer Pair (NM_010598)
MP211317 200 Reactions

Kcnab2 Mouse qPCR Primer Pair (NM_010598)

Sign In for Pricing
View Details
WDR52 HDR Plasmid (h)
sc-412602-HDR 20 µg

WDR52 HDR Plasmid (h)

Sign In for Pricing
View Details