Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubella virus Structural polyprotein, partial

This Recombinant Rubella virus Structural polyprotein, partial spans the amino acid sequence from region 301-534aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(p110) (Coat protein) (C) (E2 envelope glycoprotein) (E1 envelope glycoprotein)

UniProt

Q8VA10

Expression Region

301-534aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rubella virus (strain RN-UK86) (RUBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLQPRADMAAPPAPPQPPCAHGQHYGHHHHQLPFLGHDGHHGGTLRVGQHHRNASDVLPGHCLQGGWGCYNLSDWHQGTHVCHTKHMDFWCVEHDRPPPATPTPLTTAANSTTAATPATAPAPCHAGLNDSCGGFLSGCGPMRLRHGADTRCGRLICGLSTTAQYPPTRFACAMRWGLPPWELVVLTARPEDGWTCRGVPAHPGTRCPELVSPMGRATCSPASALWLATANALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CHAD shRNA (UAS) - Lentiviral human CHAD shRNA (UAS, GFP) (100)
GTR15111273 1 Vial

Lentiviral human CHAD shRNA (UAS) - Lentiviral human CHAD shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
SLC22A24 (HRP)
576595-01 50 µg

SLC22A24 (HRP)

Sign In for Pricing
View Details
SLC22A24 (HRP)
576595-02 100 µg

SLC22A24 (HRP)

Sign In for Pricing
View Details
Ethyl linoleate
orb1940093-01 500 mg

Ethyl linoleate

Sign In for Pricing
View Details
Ethyl linoleate
orb1940093-02 1 g

Ethyl linoleate

Sign In for Pricing
View Details
Scx (Basic Helix-Loop-Helix Transcription Factor Scleraxis, Scx) (HRP) discontinued
302734-HRP 200 µL

Scx (Basic Helix-Loop-Helix Transcription Factor Scleraxis, Scx) (HRP) discontinued

Sign In for Pricing
View Details