Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor I (IGF1)

This Recombinant Bovine Insulin-like growth factor I (IGF1) spans the amino acid sequence from region 50-119aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IGF-I) (Somatomedin)

UniProt

P07455

Expression Region

50-119aa

Tag

N-terminal hFc-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klotho
E8ET1705-88 100 µL

Klotho

Sign In for Pricing
View Details
Lentiviral mouse Cnpy3 shRNA (UAS) - Lentiviral mouse Cnpy3 shRNA (UAS, RFP) (100)
GTR15208656 1 Vial

Lentiviral mouse Cnpy3 shRNA (UAS) - Lentiviral mouse Cnpy3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human CHL1/L1CAM-2 ELISA Kit
orb381203 96 Tests

Human CHL1/L1CAM-2 ELISA Kit

Sign In for Pricing
View Details
IL18R Beta (IL18RAP) (NM_003853) Human Over-expression Lysate
LS008807 100 µg

IL18R Beta (IL18RAP) (NM_003853) Human Over-expression Lysate

Sign In for Pricing
View Details
APOL3 Goat Polyclonal Antibody
TA305719 100 µg

APOL3 Goat Polyclonal Antibody

Sign In for Pricing
View Details
CPNE3 (Copine III, CPN3, KIAA0636, PRO1071) (FITC)
244890-FITC 100 µL

CPNE3 (Copine III, CPN3, KIAA0636, PRO1071) (FITC)

Sign In for Pricing
View Details