Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transforming growth factor beta-2 (TGFB2), partial

This Recombinant Bovine Transforming growth factor beta-2 (TGFB2), partial spans the amino acid sequence from region 303-414aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Milk growth factor) (MGF) (LAP) (TGF-beta-2)

UniProt

P21214

Expression Region

303-414aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC45A4 Antibody
orb1559174-01 50 µL

SLC45A4 Antibody

Sign In for Pricing
View Details
SLC45A4 Antibody
orb1559174-02 100 µL

SLC45A4 Antibody

Sign In for Pricing
View Details
SLC45A4 Antibody
orb1559174-03 200 µL

SLC45A4 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Tbp7 Antibody [DyLight 405]
NBP2-99612V 0.1 mL

Rabbit Polyclonal Tbp7 Antibody [DyLight 405]

Sign In for Pricing
View Details
AGTPBP1 Rabbit Polyclonal Antibody
TA333833 100 µL

AGTPBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PHF14 (m) -PR
sc-106407-PR 10 µM - 20 µL

PHF14 (m) -PR

Sign In for Pricing
View Details