Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Desmin (DES)

This Recombinant Human Desmin (DES) spans the amino acid sequence from region 2-470aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P17661

Expression Region

2-470aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3498), CF405S conjugate, 0.1mg/mL
BNC043498-500 1x 500 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3498), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N,alpha-Diethylphenethylamine Hydrochloride
TRC-D444710-5MG 5 mg

N,alpha-Diethylphenethylamine Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Cartilage
CS627611 5x 5 µm

Frozen Tissue Sections, Cartilage

Sign In for Pricing
View Details
Trolox
SIH-556-1G 1 g

Trolox

Sign In for Pricing
View Details
TMPRSS11E (Center) Rabbit Polyclonal Antibody
AP54298PU-N 400 µL

TMPRSS11E (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human LIME (LIME1) activation kit by CRISPRa
GA110373 1 Kit

Human LIME (LIME1) activation kit by CRISPRa

Sign In for Pricing
View Details