Recombinant Mesocricetus auratus Interleukin-4 (IL4)
This Recombinant Mesocricetus auratus Interleukin-4 (IL4) spans the amino acid sequence from region 20-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(IL-4) (B-cell stimulatory factor 1) (BSF-1) (Lymphocyte stimulatory factor 1)
UniProt
Q60440
Expression Region
20-147aa
Tag
C-terminal 6xHis-tagged
Source
Yeast
Origin
Mesocricetus auratus (Golden hamster)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NWTLGCHHGALKEIIHILNQVTEKGTPCTEMVVPDALSARKNSTEKDLICRASQGFRKFYFQHEVTLCLKNNSRVLKDLKKLYRGISSLFPQKSCNVNESTYTTLKDFLESLRRIMQKKYWQCGSSTF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15282277 1 Vial
Lentiviral mouse Psmc2 shRNA (UAS) - Lentiviral mouse Psmc2 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
146278 100 µg
SLC35D1, CT (UDP-glucuronic Acid/UDP-N-acetylgalactosamine Transporter, UDP-GlcA/UDP-GalNAc Transporter, Solute Carrier Family 35 Member D1, UDP-galactose Transporter-related Protein 7, UGTrel7, KIAA0260, UGTREL7)
Sign In for Pricing
View Details 
NBP2-98534UV 0.1 mL
Rabbit Polyclonal NUDT22 Antibody [DyLight 350]
Sign In for Pricing
View Details