Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Deneddylase BPLF1 (BPLF1), partial

This Recombinant Epstein-Barr virus Deneddylase BPLF1 (BPLF1), partial spans the amino acid sequence from region 1-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P03186

Expression Region

1-320aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNGDWGQSQRTRGTGPVRGIRTMDVNAPGGGSGGSALRILGTASCNQAHCKFGRFAGIQCVSNCVLYLVKSFLAGRPLTSRPELDEVLDEGARLDALMRQSGILKGHEMAQLTDVPSSVVLRGGGRVHIYRSAEIFGLVLFPAQIANSAVVQSLAEVLHGSYNGVAQFILYICDIYAGAIIIETDGSFYLFDPHCQKDAAPGTPAHVRVSTYAHDILQYVGAPGAQYTCVHLYFLPEAFETEDPRIFMLEHYGVYDFYEANGSGFDLVGPELVSSDGEAAGTPGADSSPPVMLPFERRIIPYNLRPLPSRSFTSDSFPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (K8/383), Biotin conjugate, 0.1mg/mL
BNCB0383-100 1x 100 µL

Cytokeratin 8 (K8/383), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SULT4A1 Human Gene Knockout Kit (CRISPR)
KN206314LP 1 Kit

SULT4A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Acetyl-L-cysteine-13C3,15N
TRC-A172094-1MG 1 mg

N-Acetyl-L-cysteine-13C3,15N

Sign In for Pricing
View Details
IFNA1 Antibody
KC-583-01 50 μL

IFNA1 Antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-583-02 100 µL

IFNA1 Antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-583-03 1 mL

IFNA1 Antibody

Sign In for Pricing
View Details