Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial

This Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial spans the amino acid sequence from region 59-265aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Pre-GP-C) (SSP) (GP1) (GP2)

UniProt

P07399

Expression Region

59-265aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Lymphocytic choriomeningitis virus (strain WE) (LCMV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYGLNGPDIYKGVYQFKSVEFDMSHLNLTMPNACSVNNSHHYISMGSSGLEPTFTNDSILNHNFCNLTSALNKKSFDHTLMSIVSSLHLSIRGNSNYKAVSCDFNNGITIQYNLSSSDPQSAMSQCRTFRGRVLDMFRTAFGGKYMRSGWGWTGSDGKTTWCSQTSYQYLIIQNRTWENHCRYAGPFGMSRILFAQEKTKFLTRRLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Integrin Alpha L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA1A, Ly15, Ly21, Lymphocyte Function Associated Antigen Type 1 alpha, p180) (PE) discontinued
C2262-06H-PE 100 µL

CD11a (Integrin Alpha L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA1A, Ly15, Ly21, Lymphocyte Function Associated Antigen Type 1 alpha, p180) (PE) discontinued

Sign In for Pricing
View Details
TAF9 CytoSection
TS414833P5 25 Slides

TAF9 CytoSection

Sign In for Pricing
View Details
Necrostatin-1
C13143-1g 1 g

Necrostatin-1

Sign In for Pricing
View Details
NGFB (NGF, NGFB, NGFbeta, nerve growth factor beta polypeptide) (MaxLight 405) discontinued
144967-ML405 100 µL

NGFB (NGF, NGFB, NGFbeta, nerve growth factor beta polypeptide) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Polyclonal ZFHX3 / ATBF1 Antibody (aa517-787)
APR14024G 0.05mg

Polyclonal ZFHX3 / ATBF1 Antibody (aa517-787)

Sign In for Pricing
View Details
GAPDH (HRP Conjugated) Rabbit pAb
MBS8542114-01 0.1 mL

GAPDH (HRP Conjugated) Rabbit pAb

Sign In for Pricing
View Details