Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial

This Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial spans the amino acid sequence from region 59-265aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Pre-GP-C) (SSP) (GP1) (GP2)

UniProt

P07399

Expression Region

59-265aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Lymphocytic choriomeningitis virus (strain WE) (LCMV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYGLNGPDIYKGVYQFKSVEFDMSHLNLTMPNACSVNNSHHYISMGSSGLEPTFTNDSILNHNFCNLTSALNKKSFDHTLMSIVSSLHLSIRGNSNYKAVSCDFNNGITIQYNLSSSDPQSAMSQCRTFRGRVLDMFRTAFGGKYMRSGWGWTGSDGKTTWCSQTSYQYLIIQNRTWENHCRYAGPFGMSRILFAQEKTKFLTRRLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PIM1 Rabbit Monoclonal Antibody
MA4601-.05 50 µL

Anti-PIM1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Naratriptan HCl
S1488-200mg 200 mg

Naratriptan HCl

Sign In for Pricing
View Details
Mouse RING-box protein 2, Rnf7 ELISA KIT
ELI-18299m 96 Tests

Mouse RING-box protein 2, Rnf7 ELISA KIT

Sign In for Pricing
View Details
Rabbit Polyclonal LRRC57 Antibody
NBP1-83485 0.1 mL

Rabbit Polyclonal LRRC57 Antibody

Sign In for Pricing
View Details
P/P065/NT/PP-DIA315-1 Prohibited Activity Signs (No Adhesive)
241472 1 Pack (1 Panel (s) x 1 Pack)

P/P065/NT/PP-DIA315-1 Prohibited Activity Signs (No Adhesive)

Sign In for Pricing
View Details
Cutibacterium acnes PPA2105/Triacylglycerol lipase Recombinant Protein
PPT-10121 100 µg

Cutibacterium acnes PPA2105/Triacylglycerol lipase Recombinant Protein

Sign In for Pricing
View Details