Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi 17 kDa surface antigen (omp)

This Recombinant Rickettsia typhi 17 kDa surface antigen (omp) spans the amino acid sequence from region 20-159aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P22882

Expression Region

20-159aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGHGKGQLVGVGVGALLGAVLGGQIGASMDEQDRKLLELTSQRALESAPSGSNIEWRNPDNGNHGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQTTYGNACRQPDGQWQVAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit COVID-19/SARS-CoV-2 S Protein Polyclonal Antibody
orb1141358-01 100 µg

Rabbit COVID-19/SARS-CoV-2 S Protein Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit COVID-19/SARS-CoV-2 S Protein Polyclonal Antibody
orb1141358-02 500 µg

Rabbit COVID-19/SARS-CoV-2 S Protein Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit COVID-19/SARS-CoV-2 S Protein Polyclonal Antibody
orb1141358-03 1 mg

Rabbit COVID-19/SARS-CoV-2 S Protein Polyclonal Antibody

Sign In for Pricing
View Details
BTBD9 Rabbit pAb
E45R29307N 50 ul

BTBD9 Rabbit pAb

Sign In for Pricing
View Details
PGP9.5 175-191
GP14104 50 µL

PGP9.5 175-191

Sign In for Pricing
View Details
Rabbit Polyclonal ETEA Antibody
NBP2-68916 100 µL

Rabbit Polyclonal ETEA Antibody

Sign In for Pricing
View Details