Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vesicular glutamate transporter 1 (Slc17a7), partial

This Recombinant Rat Vesicular glutamate transporter 1 (Slc17a7), partial spans the amino acid sequence from region 1-63aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Brain-specific Na (+) -dependent inorganic phosphate cotransporter) (Solute carrier family 17 member 7)

UniProt

Q62634

Expression Region

1-63aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLPRRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD40/TNFRSF5 Antibody (82111) [Janelia Fluor 525]
FAB6321JF525 0.1 mL

Mouse Monoclonal CD40/TNFRSF5 Antibody (82111) [Janelia Fluor 525]

Sign In for Pricing
View Details
4- ((4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) sulfonyl) morpholine
OR1031810-01 250 mg

4- ((4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) sulfonyl) morpholine

Sign In for Pricing
View Details
4- ((4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) sulfonyl) morpholine
OR1031810-02 1 g

4- ((4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) sulfonyl) morpholine

Sign In for Pricing
View Details
4- ((4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) sulfonyl) morpholine
OR1031810-03 5 g

4- ((4- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) sulfonyl) morpholine

Sign In for Pricing
View Details
NFE2L1 sgRNA CRISPR Lentivector set (Human)
K1421701 3x 1.0 µg

NFE2L1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
FRF-06-057
orb2814327-01 10 mg

FRF-06-057

Sign In for Pricing
View Details