Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ab (cry1Ab), partial
Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ab (cry1Ab), partial
Product Specifications
UniProt
P0A370
Tag
N-terminal 6xHis-tagged
Purity
Greater than 90% as determined by SDS-PAGE.
Molecular Weight
Calculated MW 17.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Preservative
Tris-based buffer, 50% glycerol
AA Sequence
HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040040-100 1x 100 µL
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC700745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740217-500 1x 500 µL
Human IgG Immunoglobulin (IG217), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681887-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680756-100 1x 100 µL
Neurofilament (H+L) (NF421 + NFL736), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details