Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A3N, Mouse (P.pastoris, His)

The serpin A3N protein is ubiquitously found in a variety of tissues, showing elevated expression in the brain, heart, liver, lung, spleen, testis, and thymus, implying a variety of physiological functions.In contrast, it shows lower expression in bone marrow, kidney, and skeletal muscle, suggesting a tissue-specific pattern of regulation.Serpin A3N Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Serpin A3N protein, expressed by P.pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A3N Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a3n-protein-mouse-p-pastoris-his.html

Purity

92.00

Smiles

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Molecular Formula

20716 (Gene_ID) Q91WP6 (F21-K418) (Accession)

Molecular Weight

Approximately 46.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN2 Rabbit Polyclonal Antibody (Biotin)
orb2586337 100 µg

NSUN2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ALDH4A1 Antibody (C-term)
E45G01765G-1 100 µL

ALDH4A1 Antibody (C-term)

Sign In for Pricing
View Details
Muc15 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6330004 1.0 µg DNA

Muc15 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
DDX50P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV759891 1.0 µg DNA

DDX50P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Large-conductance mechanosensitive channel (mscL)
MBS7021102-01 0.02 mg

Recombinant Escherichia coli O17:K52:H18 Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Large-conductance mechanosensitive channel (mscL)
MBS7021102-02 0.1 mg

Recombinant Escherichia coli O17:K52:H18 Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details