Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial
Product NameRecombinant Human Sodium, glucose cotransporter 2 (SLC5A2), partial
Product Specifications
UniProt
P31639
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Field of Research
Pharmacology & Drug Discovery
Purity
Greater than 90% as determined by SDS-PAGE
Form
Tris-based buffer 50% glycerol
Molecular Weight
15.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
AA Sequence
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1032247-01 0.02 mg (E-Coli)
Recombinant Saccharomyces cerevisiae Ubiquitin-conjugating enzyme suppressor 1 (UBS1)
Sign In for Pricing
View Details MBS1032247-02 0.02 mg (Yeast)
Recombinant Saccharomyces cerevisiae Ubiquitin-conjugating enzyme suppressor 1 (UBS1)
Sign In for Pricing
View Details MBS1032247-03 0.1 mg (E-Coli)
Recombinant Saccharomyces cerevisiae Ubiquitin-conjugating enzyme suppressor 1 (UBS1)
Sign In for Pricing
View Details MBS1032247-04 0.1 mg (Yeast)
Recombinant Saccharomyces cerevisiae Ubiquitin-conjugating enzyme suppressor 1 (UBS1)
Sign In for Pricing
View Details