Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial
Product NameRecombinant Human Sodium, glucose cotransporter 2 (SLC5A2), partial
Product Specifications
UniProt
P31639
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Field of Research
Pharmacology & Drug Discovery
Purity
Greater than 90% as determined by SDS-PAGE
Form
Tris-based buffer 50% glycerol
Molecular Weight
15.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
AA Sequence
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10360486 96 Well
Chicken BR serine/threonine protein kinase 1 (BRSK1) ELISA Kit
Sign In for Pricing
View Details VAng-Cr2788-50gEcoli 50 µg (E. coli)
Recombinant Vibrio Cholerae VCM66_0205 Protein (aa 1-224)
Sign In for Pricing
View Details