What sizes are available for Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active)?

Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active) is available in the following size(s): 1 mg.

Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active)

Q: What is the catalog number for Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active)?

The catalog number for Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active) is orb1646261.

Product Specifications

Product Name Alternative

33 kDa housekeeping protein Peroxin-19 Peroxisomal farnesylated protein

UniProt

P40855

Tag

N-terminal GST-tagged

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 g, ml can bind human PEX19, the EC50 of human PEX19 protein is 22.96-33.00 g, ml.

Form

Tris-based buffer, 50% glycerol

Molecular Weight

59.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

AA Sequence

AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC