Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor II (IGF2), partial

This Recombinant Bovine Insulin-like growth factor II (IGF2), partial spans the amino acid sequence from region 25-91aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IGF-II) (Erythrotropin)

UniProt

P07456

Expression Region

25-91aa

Tag

N-terminal hFc-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr736 Recombinant Protein (Mouse)
RP158639 100 µg

Olfr736 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
BCAS4 Rabbit Polyclonal Antibody
E10G04716 100 µL

BCAS4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse GABBR2 Ready-To-Use IHC Kit
IHC0385M 50 Tests

Mouse GABBR2 Ready-To-Use IHC Kit

Sign In for Pricing
View Details
Circulating tumor cell detection kit (anti-EpCAM Ab Magbeads)
MBS8579435-01 20 Tests

Circulating tumor cell detection kit (anti-EpCAM Ab Magbeads)

Sign In for Pricing
View Details
Circulating tumor cell detection kit (anti-EpCAM Ab Magbeads)
MBS8579435-02 5x 20 Tests

Circulating tumor cell detection kit (anti-EpCAM Ab Magbeads)

Sign In for Pricing
View Details
Mouse Monoclonal Uroplakin Ib Antibody (UPK1B/3081) [Alexa Fluor 594]
NBP2-79933AF594 0.1 mL

Mouse Monoclonal Uroplakin Ib Antibody (UPK1B/3081) [Alexa Fluor 594]

Sign In for Pricing
View Details