Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA-directed RNA polymerase III subunit RPC1 (POLR3A), partial

This Recombinant Human DNA-directed RNA polymerase III subunit RPC1 (POLR3A), partial spans the amino acid sequence from region 392-632aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(RNA polymerase III subunit C1) (DNA-directed RNA polymerase III largest subunit) (DNA-directed RNA polymerase III subunit A) (RNA polymerase III 155 kDa subunit) (RPC155) (RNA polymerase III subunit C160)

UniProt

O14802

Expression Region

392-632aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Interleukin 1 (IL-1) ELISA Kit
YP-W72055-01 48 Tests

Rabbit Interleukin 1 (IL-1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 1 (IL-1) ELISA Kit
YP-W72055-02 96 Tests

Rabbit Interleukin 1 (IL-1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CXCL10/IP-10/CRG-2 Antibody (33036R) [Allophycocyanin]
FAB266RA 0.1 mL

Mouse Monoclonal CXCL10/IP-10/CRG-2 Antibody (33036R) [Allophycocyanin]

Sign In for Pricing
View Details
Pam (NM_013626) Mouse Tagged ORF Clone
MR223751 10 µg

Pam (NM_013626) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ZNF264 (NM_003417) Human Over-expression Lysate
LY418709 100 µg

ZNF264 (NM_003417) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc9b1 Protein Lysate (Human) with C-Ha Tag
44311031 100 µg

Slc9b1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details