Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage Receptor MARCO/MARCO (N-8His)

Recombinant Mouse Macrophage Receptor MARCO/MARCO (N-8His)

Product Specifications

UniProt

Q60754

Reactivity

Mouse

Field of Research

Immunology & Inflammation

Endotoxin

Less than 0.1 ng, μg (1 IEU, μg) as determined by LAL test.

Purity

Greater than 95%

Molecular Weight

46.2kDa

Storage Conditions

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Notes

For research use only.

Preservative

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4

AA Sequence

HHHHHHHHQVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LILRB1/CD85j/ILT2, C-His, Flag Tag (ECD)
HA210718-01 20 µg

Human LILRB1/CD85j/ILT2, C-His, Flag Tag (ECD)

Sign In for Pricing
View Details
Human LILRB1/CD85j/ILT2, C-His, Flag Tag (ECD)
HA210718-02 50 µg

Human LILRB1/CD85j/ILT2, C-His, Flag Tag (ECD)

Sign In for Pricing
View Details
Human LILRB1/CD85j/ILT2, C-His, Flag Tag (ECD)
HA210718-03 100 µg

Human LILRB1/CD85j/ILT2, C-His, Flag Tag (ECD)

Sign In for Pricing
View Details
Recombinant XBP1 Antibody
RC-16930-01 50 μL

Recombinant XBP1 Antibody

Sign In for Pricing
View Details
Recombinant XBP1 Antibody
RC-16930-02 100 µL

Recombinant XBP1 Antibody

Sign In for Pricing
View Details
Recombinant XBP1 Antibody
RC-16930-03 1 mL

Recombinant XBP1 Antibody

Sign In for Pricing
View Details