Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage Receptor MARCO/MARCO (N-8His)

Recombinant Mouse Macrophage Receptor MARCO/MARCO (N-8His)

Product Specifications

UniProt

Q60754

Reactivity

Mouse

Field of Research

Immunology & Inflammation

Endotoxin

Less than 0.1 ng, μg (1 IEU, μg) as determined by LAL test.

Purity

Greater than 95%

Molecular Weight

46.2kDa

Storage Conditions

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Notes

For research use only.

Preservative

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4

AA Sequence

HHHHHHHHQVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF673 (KRBOX4) (NM_017776) Human Recombinant Protein
TP761161 50 µg

ZNF673 (KRBOX4) (NM_017776) Human Recombinant Protein

Sign In for Pricing
View Details
Human IGFBP3 Recombinant Rabbit monoclonal Antibody
HA723433 100 µL

Human IGFBP3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Proflavine Hemisulfate
TRC-P014645-5G 5 g

Proflavine Hemisulfate

Sign In for Pricing
View Details
C10ORF132 (GOLGA7B) (NM_001010917) Human Over-expression Lysate
LY423228 100 µg

C10ORF132 (GOLGA7B) (NM_001010917) Human Over-expression Lysate

Sign In for Pricing
View Details
PON3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]
TA807380AM 100 µL

PON3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]

Sign In for Pricing
View Details
FITC Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163C-01 20 Tests

FITC Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details