Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (227a.a)

OSM Protein, Human (227a.a) is a polypeptide chain containing 227 amino acids. Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism.

Product Specifications

Product Name Alternative

OSM Protein, Human (227a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-227a-a.html

Purity

95.99

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R252) (Accession)

Molecular Weight

Approximately 25.9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hermanns HM, et al. Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :545-58.|[2]Gómez-Lechón MJ, et al. Oncostatin M: signal transduction and biological activity. Life Sci. 1999;65 (20) :2019-30.|[3]Chen SH, et al. Oncostatin M: a pleiotropic cytokine in the central nervous system. Cytokine Growth Factor Rev. 2004 Oct;15 (5) :379-91.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PKC theta Antibody
MBS9412405-01 0.1 mL

PKC theta Antibody

Ask
View Details
PKC theta Antibody
MBS9412405-02 5x 0.1 mL

PKC theta Antibody

Ask
View Details
Mouse Synovial Fibroblasts
RPC-517 5x 10^5

Mouse Synovial Fibroblasts

Ask
View Details
Licogliflozin 100mg
A12828-100 100 mg

Licogliflozin 100mg

Ask
View Details
Donkey Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit
MBS9918718 Inquire

Donkey Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit

Ask
View Details
FOLR1 (Folate Receptor alpha, FR-alpha, Adult Folate-binding Protein, FBP, Folate Receptor 1, Folate Receptor, Adult, KB cells FBP, Ovarian Tumor-associated Antigen MOv18, FOLR)
140347 200 µL

FOLR1 (Folate Receptor alpha, FR-alpha, Adult Folate-binding Protein, FBP, Folate Receptor 1, Folate Receptor, Adult, KB cells FBP, Ovarian Tumor-associated Antigen MOv18, FOLR)

Ask
View Details