Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (227a.a)

OSM Protein, Human (227a.a) is a polypeptide chain containing 227 amino acids. Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism.

Product Specifications

Product Name Alternative

OSM Protein, Human (227a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-227a-a.html

Purity

95.99

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R252) (Accession)

Molecular Weight

Approximately 25.9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hermanns HM, et al. Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :545-58.|[2]Gómez-Lechón MJ, et al. Oncostatin M: signal transduction and biological activity. Life Sci. 1999;65 (20) :2019-30.|[3]Chen SH, et al. Oncostatin M: a pleiotropic cytokine in the central nervous system. Cytokine Growth Factor Rev. 2004 Oct;15 (5) :379-91.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PEX13 Antibody, Biotin conjugated
A64757-100UG 100 µg

PEX13 Antibody, Biotin conjugated

Ask
View Details
DDIT3 Rabbit Monoclonal Antibody
E49Y6694 100 µL

DDIT3 Rabbit Monoclonal Antibody

Ask
View Details
Mouse Gabrg3 activation kit by CRISPRa
GA201524 1 Kit

Mouse Gabrg3 activation kit by CRISPRa

Ask
View Details
Rabbit Polyclonal SFRS3 Antibody [FITC]
NBP2-41316F 0.1 mL

Rabbit Polyclonal SFRS3 Antibody [FITC]

Ask
View Details
Recombinant Human B-cell CLL/lymphoma 7 protein family member A (BCL7A)
MBS1335877-01 0.02 mg (E-Coli)

Recombinant Human B-cell CLL/lymphoma 7 protein family member A (BCL7A)

Ask
View Details
Recombinant Human B-cell CLL/lymphoma 7 protein family member A (BCL7A)
MBS1335877-02 0.02 mg (Yeast)

Recombinant Human B-cell CLL/lymphoma 7 protein family member A (BCL7A)

Ask
View Details