Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (227a.a)

OSM Protein, Human (227a.a) is a polypeptide chain containing 227 amino acids. Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism.

Product Specifications

Product Name Alternative

OSM Protein, Human (227a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-227a-a.html

Purity

95.99

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R252) (Accession)

Molecular Weight

Approximately 25.9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hermanns HM, et al. Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :545-58.|[2]Gómez-Lechón MJ, et al. Oncostatin M: signal transduction and biological activity. Life Sci. 1999;65 (20) :2019-30.|[3]Chen SH, et al. Oncostatin M: a pleiotropic cytokine in the central nervous system. Cytokine Growth Factor Rev. 2004 Oct;15 (5) :379-91.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Monoclonal Epiregulin Antibody (6H12) [Biotin]
NBP2-21992B 0.1 mL

Rat Monoclonal Epiregulin Antibody (6H12) [Biotin]

Ask
View Details
PROX1 (prospero Homeobox 1) (PE)
250532-PE 100 µL

PROX1 (prospero Homeobox 1) (PE)

Ask
View Details
Guinea pig protein kinase C, beta II (PRKCB) ELISA Kit
MBS2613092-01 48 Well

Guinea pig protein kinase C, beta II (PRKCB) ELISA Kit

Ask
View Details
Guinea pig protein kinase C, beta II (PRKCB) ELISA Kit
MBS2613092-02 96 Well

Guinea pig protein kinase C, beta II (PRKCB) ELISA Kit

Ask
View Details
Guinea pig protein kinase C, beta II (PRKCB) ELISA Kit
MBS2613092-03 5x 96 Well

Guinea pig protein kinase C, beta II (PRKCB) ELISA Kit

Ask
View Details
Guinea pig protein kinase C, beta II (PRKCB) ELISA Kit
MBS2613092-04 10x 96 Well

Guinea pig protein kinase C, beta II (PRKCB) ELISA Kit

Ask
View Details