Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (227a.a)

OSM Protein, Human (227a.a) is a polypeptide chain containing 227 amino acids. Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism.

Product Specifications

Product Name Alternative

OSM Protein, Human (227a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-227a-a.html

Purity

95.99

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R252) (Accession)

Molecular Weight

Approximately 25.9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hermanns HM, et al. Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :545-58.|[2]Gómez-Lechón MJ, et al. Oncostatin M: signal transduction and biological activity. Life Sci. 1999;65 (20) :2019-30.|[3]Chen SH, et al. Oncostatin M: a pleiotropic cytokine in the central nervous system. Cytokine Growth Factor Rev. 2004 Oct;15 (5) :379-91.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ptpn18 siRNA Oligos set (Mouse)
38151174 3x 5 nmol

Ptpn18 siRNA Oligos set (Mouse)

Ask
View Details
PSMA2 (Proteasome Subunit Alpha Type-2, Proteasome (Prosome, Macropain) Subunit, Alpha Type, 2)
489574 100 µL

PSMA2 (Proteasome Subunit Alpha Type-2, Proteasome (Prosome, Macropain) Subunit, Alpha Type, 2)

Ask
View Details
Human MARCO Protein, His Tag (MALS verified)
MAR-H5243-1mg 1 mg

Human MARCO Protein, His Tag (MALS verified)

Ask
View Details
WAY-204688 1mg
A20757-1 1 mg

WAY-204688 1mg

Ask
View Details
Mink ACE2 / ACEH Protein, His Tag (MALS & SPR verified)
AC2-M52H3-50ug 50 µg

Mink ACE2 / ACEH Protein, His Tag (MALS & SPR verified)

Ask
View Details
Human APOC3 knockdown cell line
ABC-KD0819 1 Vial

Human APOC3 knockdown cell line

Ask
View Details