What is the catalog number for FITC amyloid peptide 1-40?

The catalog number for FITC amyloid peptide 1-40 is amp40f-0.5mg.

What sizes are available for FITC amyloid peptide 1-40?

FITC amyloid peptide 1-40 is available in the following size(s): 0.5 mg.

FITC amyloid peptide 1-40 is currently made to order / not held in immediate stock. Contact us for lead time.

FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

≥95%

-20°C

24 months

40

More Discoveries

Browse additional items from our catalog

TU102662 1.0 mL

Sign In for Pricing

PVT19976 2 µg

Sign In for Pricing

MBS170431 Inquire

Sign In for Pricing

APA1047-01 30 µL

Sign In for Pricing

APA1047-02 50 μL

Sign In for Pricing

APA1047-03 100 µL

Sign In for Pricing