What is the catalog number for FITC amyloid peptide 1-40?

The catalog number for FITC amyloid peptide 1-40 is amp40f-0.5mg.

What sizes are available for FITC amyloid peptide 1-40?

FITC amyloid peptide 1-40 is available in the following size(s): 0.5 mg.

FITC amyloid peptide 1-40 is currently made to order / not held in immediate stock. Contact us for lead time.

FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

≥95%

-20°C

24 months

40

More Discoveries

Browse additional items from our catalog

MR213579L3V 200 µL

Sign In for Pricing

JBS-NU-849-25 25 mg

Sign In for Pricing

STJ95871 200 µl

Sign In for Pricing

462789-01 1 mg

Sign In for Pricing

462789-02 2.5 mg

Sign In for Pricing

260823-01 250 mg

Sign In for Pricing