Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calmegin/CLGN, Human (HEK293, His)

Calmegin Protein, Human (HEK293, His), a recombinant human Calmegin produced in HEK293 cells, has a His tag at the N-terminus. Calmegin is a testis-specific molecular chaperon playing a key role in spermatogenesis[1].

Product Specifications

Product Name Alternative

Calmegin/CLGN Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calmegin-protein-human-hek293-his.html

Purity

98.0

Smiles

EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWHHHHHH

Molecular Formula

1047 (Gene_ID) O14967-1 (E20-W471) (Accession)

Molecular Weight

Approximately 60-63 kDa

References & Citations

[1]Dong Hoon Kim, et al. Coordinated transcriptional regulation of calmegin, a testis-specific molecular chaperon, by histone deacetylase and CpG methyltransferase. Exp Mol Med. 2005 Oct 31;37 (5) :492-6.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elane sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3714802 1.0 µg DNA

Elane sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)
abx303657-01 20 µg

Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)

Sign In for Pricing
View Details
Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)
abx303657-02 50 µg

Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)

Sign In for Pricing
View Details
Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)
abx303657-03 100 µg

Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)

Sign In for Pricing
View Details
Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)
abx303657-04 200 µg

Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)

Sign In for Pricing
View Details
Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)
abx303657-05 1 mg

Terminal Deoxynucleotidyltransferase (DNTT) Antibody (Biotin)

Sign In for Pricing
View Details