Calmegin/CLGN, Human (HEK293, His)
Calmegin Protein, Human (HEK293, His), a recombinant human Calmegin produced in HEK293 cells, has a His tag at the N-terminus. Calmegin is a testis-specific molecular chaperon playing a key role in spermatogenesis[1].
Product Specifications
Product Name Alternative
Calmegin/CLGN Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/calmegin-protein-human-hek293-his.html
Purity
98.0
Smiles
EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWHHHHHH
Molecular Formula
1047 (Gene_ID) O14967-1 (E20-W471) (Accession)
Molecular Weight
Approximately 60-63 kDa
References & Citations
[1]Dong Hoon Kim, et al. Coordinated transcriptional regulation of calmegin, a testis-specific molecular chaperon, by histone deacetylase and CpG methyltransferase. Exp Mol Med. 2005 Oct 31;37 (5) :492-6.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402823-100 1x 100 µL
BMI1 (Oncogene and Stem Cell Marker) (BMI1/2823), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details