Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calmegin/CLGN, Human (HEK293, His)

Calmegin Protein, Human (HEK293, His), a recombinant human Calmegin produced in HEK293 cells, has a His tag at the N-terminus. Calmegin is a testis-specific molecular chaperon playing a key role in spermatogenesis[1].

Product Specifications

Product Name Alternative

Calmegin/CLGN Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calmegin-protein-human-hek293-his.html

Purity

98.0

Smiles

EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWHHHHHH

Molecular Formula

1047 (Gene_ID) O14967-1 (E20-W471) (Accession)

Molecular Weight

Approximately 60-63 kDa

References & Citations

[1]Dong Hoon Kim, et al. Coordinated transcriptional regulation of calmegin, a testis-specific molecular chaperon, by histone deacetylase and CpG methyltransferase. Exp Mol Med. 2005 Oct 31;37 (5) :492-6.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) ASN1 Polyclonal Antibody
MBS7143196 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) ASN1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Shigella Sonnei apaG Protein (aa 1-125)
VAng-Lsx09517-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei apaG Protein (aa 1-125)

Sign In for Pricing
View Details
Emr4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV647427 1.0 µg DNA

Emr4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Ldb2 3'UTR Luciferase Stable Cell Line
TU110971 1.0 mL

Ldb2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal EDA/Ectodysplasin Antibody (Renzo-2) [DyLight 350]
NBP2-59772UV-0.1mL 0.1 mL

Mouse Monoclonal EDA/Ectodysplasin Antibody (Renzo-2) [DyLight 350]

Sign In for Pricing
View Details
HBZ, CT (HBZ, HBZ2, Hemoglobin subunit zeta, HBAZ, Hemoglobin zeta chain, Zeta-globin) (MaxLight 550) discontinued
036452-ML550 100 µL

HBZ, CT (HBZ, HBZ2, Hemoglobin subunit zeta, HBAZ, Hemoglobin zeta chain, Zeta-globin) (MaxLight 550) discontinued

Sign In for Pricing
View Details