Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calmegin/CLGN, Human (HEK293, His)

Calmegin Protein, Human (HEK293, His), a recombinant human Calmegin produced in HEK293 cells, has a His tag at the N-terminus. Calmegin is a testis-specific molecular chaperon playing a key role in spermatogenesis[1].

Product Specifications

Product Name Alternative

Calmegin/CLGN Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calmegin-protein-human-hek293-his.html

Purity

98.0

Smiles

EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWHHHHHH

Molecular Formula

1047 (Gene_ID) O14967-1 (E20-W471) (Accession)

Molecular Weight

Approximately 60-63 kDa

References & Citations

[1]Dong Hoon Kim, et al. Coordinated transcriptional regulation of calmegin, a testis-specific molecular chaperon, by histone deacetylase and CpG methyltransferase. Exp Mol Med. 2005 Oct 31;37 (5) :492-6.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal AlphaB Crystallin/CRYAB Antibody (CRYAB/7917) [Alexa Fluor 750]
NBP3-20785AF750 0.1 mL

Mouse Monoclonal AlphaB Crystallin/CRYAB Antibody (CRYAB/7917) [Alexa Fluor 750]

Sign In for Pricing
View Details
Ccdc22 Rat shRNA Plasmid (Locus ID 317381)
TR709010 1 Kit

Ccdc22 Rat shRNA Plasmid (Locus ID 317381)

Sign In for Pricing
View Details
Ctnnd1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6439404 1.0 µg DNA

Ctnnd1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant ASFV Ken-082 Protein (aa 1-45)
VAng-0847Lsx-500g 500 µg

Recombinant ASFV Ken-082 Protein (aa 1-45)

Sign In for Pricing
View Details
LMAN2 (NM_006816) Human Recombinant Protein
PH39230M5 20 µg

LMAN2 (NM_006816) Human Recombinant Protein

Sign In for Pricing
View Details
MRPL24 (39S Ribosomal Protein L24, Mitochondrial, L24mt, MRP-L24)
324388-01 50 µg

MRPL24 (39S Ribosomal Protein L24, Mitochondrial, L24mt, MRP-L24)

Sign In for Pricing
View Details