Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDLR, Human (HEK293, His)

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293, His) is the recombinant human-derived LDLR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LDLR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ldlr-protein-human-hek-293-his.html

Purity

95.00

Smiles

AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVR

Molecular Formula

3949 (Gene_ID) P01130-1 (A22-R788) (Accession)

Molecular Weight

Approximately 99-140 kDa due to the glycosylation.

References & Citations

[1]Bovenschen N, et al., LDL receptor cooperates with LDL receptor-related protein in regulating plasma levels of coagulation factor VIII in vivo. Blood. 2005 Aug 1;106 (3) :906-12.|[2]Zegeye MM, et al., Soluble LDL-receptor is induced by TNF-α and inhibits hepatocytic clearance of LDL-cholesterol. J Mol Med (Berl) . 2023 Dec;101 (12) :1615-1626.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Adrenocorticotropic Hormone Receptor (MC2R) ELISA Kit
MBS7262445-01 48 Well

Monkey Adrenocorticotropic Hormone Receptor (MC2R) ELISA Kit

Sign In for Pricing
View Details
Monkey Adrenocorticotropic Hormone Receptor (MC2R) ELISA Kit
MBS7262445-02 96 Well

Monkey Adrenocorticotropic Hormone Receptor (MC2R) ELISA Kit

Sign In for Pricing
View Details
Monkey Adrenocorticotropic Hormone Receptor (MC2R) ELISA Kit
MBS7262445-03 5x 96 Well

Monkey Adrenocorticotropic Hormone Receptor (MC2R) ELISA Kit

Sign In for Pricing
View Details
Monkey Adrenocorticotropic Hormone Receptor (MC2R) ELISA Kit
MBS7262445-04 10x 96 Well

Monkey Adrenocorticotropic Hormone Receptor (MC2R) ELISA Kit

Sign In for Pricing
View Details
GENLISA Human Calccn Binding Protein (CACYBP) ELISA
KBH8444 1x 96 Well

GENLISA Human Calccn Binding Protein (CACYBP) ELISA

Sign In for Pricing
View Details
Cyp3a13 Antibody; FITC conjugated
MBS7002987-01 0.05 mg

Cyp3a13 Antibody; FITC conjugated

Sign In for Pricing
View Details