Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDLR, Human (HEK293, His)

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293, His) is the recombinant human-derived LDLR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LDLR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ldlr-protein-human-hek-293-his.html

Purity

95.00

Smiles

AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVR

Molecular Formula

3949 (Gene_ID) P01130-1 (A22-R788) (Accession)

Molecular Weight

Approximately 99-140 kDa due to the glycosylation.

References & Citations

[1]Bovenschen N, et al., LDL receptor cooperates with LDL receptor-related protein in regulating plasma levels of coagulation factor VIII in vivo. Blood. 2005 Aug 1;106 (3) :906-12.|[2]Zegeye MM, et al., Soluble LDL-receptor is induced by TNF-α and inhibits hepatocytic clearance of LDL-cholesterol. J Mol Med (Berl) . 2023 Dec;101 (12) :1615-1626.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPE (NM_007263) Human Over-expression Lysate
LH08598V 100 µg

COPE (NM_007263) Human Over-expression Lysate

Sign In for Pricing
View Details
ANCR Protein Vector (Human) (pPB-C-His)
PV062121 500 ng

ANCR Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Beta-2-Microglobulin ELISA Kit
MBS075452-01 48 Well

Mouse Beta-2-Microglobulin ELISA Kit

Sign In for Pricing
View Details
Mouse Beta-2-Microglobulin ELISA Kit
MBS075452-02 96 Well

Mouse Beta-2-Microglobulin ELISA Kit

Sign In for Pricing
View Details
Mouse Beta-2-Microglobulin ELISA Kit
MBS075452-03 5x 96 Well

Mouse Beta-2-Microglobulin ELISA Kit

Sign In for Pricing
View Details
Mouse Beta-2-Microglobulin ELISA Kit
MBS075452-04 10x 96 Well

Mouse Beta-2-Microglobulin ELISA Kit

Sign In for Pricing
View Details