Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carboxypeptidase D (CPD), partial

Product Specifications

Product Name Alternative

Metallocarboxypeptidase D gp180

Abbreviation

Recombinant Human CPD protein, partial

Gene Name

CPD

UniProt

O75976

Expression Region

383-461aa

Organism

Homo sapiens (Human)

Target Sequence

GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP

Tag

C-terminal hFc1-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Catalytic activity Releases C-terminal Arg and Lys from polypeptides. EC:3.4.17.22

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.3 kDa

References & Citations

"Sequence of human carboxypeptidase D reveals it to be a member of the regulatory carboxypeptidase family with three tandem active site domains." Tan F., Rehli M., Krause S.W., Skidgel R.A. Biochem. J. 327:81-87 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p75 NGF Receptor (NGFR) (NM_002507) Human Recombinant Protein
TP307966M 100 µg

p75 NGF Receptor (NGFR) (NM_002507) Human Recombinant Protein

Sign In for Pricing
View Details
N-Allylthiourea
TRC-A572403-5G 5 g

N-Allylthiourea

Sign In for Pricing
View Details
Human Pur B (PURB) activation kit by CRISPRa
GA103953 1 Kit

Human Pur B (PURB) activation kit by CRISPRa

Sign In for Pricing
View Details
Human CAAP1 activation kit by CRISPRa
GA112705 1 Kit

Human CAAP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Hardwood lignin (birch)
AS16 3975 1 Each

Anti-Hardwood lignin (birch)

Sign In for Pricing
View Details
Human COL6α1 (Collagen Type VI Alpha 1) CLIA Kit
E-CL-H0560-01 24 Tests

Human COL6α1 (Collagen Type VI Alpha 1) CLIA Kit

Sign In for Pricing
View Details