Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carboxypeptidase D (CPD), partial

Product Specifications

Product Name Alternative

Metallocarboxypeptidase D gp180

Abbreviation

Recombinant Human CPD protein, partial

Gene Name

CPD

UniProt

O75976

Expression Region

383-461aa

Organism

Homo sapiens (Human)

Target Sequence

GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP

Tag

C-terminal hFc1-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Catalytic activity Releases C-terminal Arg and Lys from polypeptides. EC:3.4.17.22

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.3 kDa

References & Citations

"Sequence of human carboxypeptidase D reveals it to be a member of the regulatory carboxypeptidase family with three tandem active site domains." Tan F., Rehli M., Krause S.W., Skidgel R.A. Biochem. J. 327:81-87 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX59 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F8]
TA800437BM 100 µL

DDX59 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F8]

Sign In for Pricing
View Details
MARK2 Antibody
KW-43901-01 50 μL

MARK2 Antibody

Sign In for Pricing
View Details
MARK2 Antibody
KW-43901-02 100 µL

MARK2 Antibody

Sign In for Pricing
View Details
MARK2 Antibody
KW-43901-03 1 mL

MARK2 Antibody

Sign In for Pricing
View Details
Human FAM22A (NUTM2A) activation kit by CRISPRa
GA118911 1 Kit

Human FAM22A (NUTM2A) activation kit by CRISPRa

Sign In for Pricing
View Details
HOXD1 (NM_024501) Human Over-expression Lysate
LC402994 20 µg

HOXD1 (NM_024501) Human Over-expression Lysate

Sign In for Pricing
View Details