Neuritin, Human (N-His)
Neutritin is a key factor in neural development, significantly enhancing neurite growth and branching in hippocampal and cortical cells. In the AMPA receptor (AMPAR) complex, neuronal proteins help form the outer core and regulate the function and properties of these receptors. Neuritin Protein, Human (N-His) is the recombinant human-derived Neuritin protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Neuritin Protein, Human (N-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/neuritin-protein-human-n-his.html
Purity
95.0
Smiles
AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN
Molecular Formula
51299 (Gene_ID) Q9NPD7 (A28-N115) (Accession)
Molecular Weight
Approximately 11 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
PRL1 (Protein Tyrosine Phosphatase Type IVA 1, Protein-tyrosine Phosphatase 4a1, Protein-tyrosine Phosphatase Of Regenerating Liver 1, PRL-1, PTP(CAAXI), PTP4A1, PTPCAAX1) (AP)
PRL1 (Protein Tyrosine Phosphatase Type IVA 1, Protein-tyrosine Phosphatase 4a1, Protein-tyrosine Phosphatase Of Regenerating Liver 1, PRL-1, PTP(CAAXI), PTP4A1, PTPCAAX1) (AP)