Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuritin, Human (N-His)

Neutritin is a key factor in neural development, significantly enhancing neurite growth and branching in hippocampal and cortical cells. In the AMPA receptor (AMPAR) complex, neuronal proteins help form the outer core and regulate the function and properties of these receptors. Neuritin Protein, Human (N-His) is the recombinant human-derived Neuritin protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Neuritin Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuritin-protein-human-n-his.html

Purity

95.0

Smiles

AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN

Molecular Formula

51299 (Gene_ID) Q9NPD7 (A28-N115) (Accession)

Molecular Weight

Approximately 11 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-100 1x 100 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-500 1x 500 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (ICAM3/2873R), CF640R conjugate, 0.1mg/mL
BNC402873-100 1x 100 µL

CD50 / ICAM3 (ICAM3/2873R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details