Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Human (HEK293, His)

Cathepsin S Protein, Human (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-human-hek293-his.html

Purity

96.73

Smiles

QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Molecular Formula

1520 (Gene_ID) NP_004070.3 (Q17-I331) (Accession)

Molecular Weight

37 kDa

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP1P1 3'UTR Luciferase Stable Cell Line
TU028629 1.0 mL

YAP1P1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SGCE (NM_003919) Human Tagged ORF Clone
RC205363 10 µg

SGCE (NM_003919) Human Tagged ORF Clone

Sign In for Pricing
View Details
Parp3 AAV siRNA Pooled Vector
36032166 1.0 µg

Parp3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Influenza A H7N9 (A/Shanghai/1/2013) HA protein, His Tag
E40VAG222 20 µg

Influenza A H7N9 (A/Shanghai/1/2013) HA protein, His Tag

Sign In for Pricing
View Details
ISX9, Neurogenic differentiation inducer
TBI1357-25MG 25 mg

ISX9, Neurogenic differentiation inducer

Sign In for Pricing
View Details
KRIBB3
T71965 5 mg

KRIBB3

Sign In for Pricing
View Details