Question 1

What is the catalog number for Commd8-set siRNA/shRNA/RNAi Lentivector (Mouse)?

Accepted Answer

The catalog number for Commd8-set siRNA/shRNA/RNAi Lentivector (Mouse) is 16615094.

Question 2

What sizes are available for Commd8-set siRNA/shRNA/RNAi Lentivector (Mouse)?

Accepted Answer

Commd8-set siRNA/shRNA/RNAi Lentivector (Mouse) is available in the following size(s): 4x 500 ng.

Question 3

Is Commd8-set siRNA/shRNA/RNAi Lentivector (Mouse) in stock?

Accepted Answer

Commd8-set siRNA/shRNA/RNAi Lentivector (Mouse) is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

Does this product need any special customs documentation to be imported to my country?

Accepted Answer

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

Question 5

What buffer is this product supplied in?

Accepted Answer

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

Question 6

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

Accepted Answer

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Commd8-set siRNA/shRNA/RNAi Lentivector (Mouse)

Product Specifications

Gene Name

Gene Aliases

Accession Number

Vector Name

Origin

Shipping Conditions

Storage Conditions

Frequently Asked Questions

Explore Other Products

CAMP sgRNA CRISPR Lentivector (Human) (Target 2)

Rabbit Anti-STC1 Polyclonal Antibody

PLD2 Knockout HCT 116 Cell Line

CRS2A Antibody

Mouse Atad3 ELISA KIT

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH