Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANK L/TNFSF11, Mouse

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs) . RANKL/TNFSF11 Protein, Mouse is a recombinant mouse RANKL (Q137-D316) without tag, which is produced in E.coli[1][2].

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rank-l-tnfsf11-protein-mouse.html

Purity

98.00

Smiles

QRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (Q137-D316) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hofbauer LC, et al. Role of receptor activator of nuclear factor-kappaB ligand and osteoprotegerin in bone cell biology. J Mol Med (Berl) . 2001 Jun;79 (5-6) :243-53.|[2]Ono T, et al. RANKL biology: bone metabolism, the immune system, and beyond. Inflamm Regen. 2020 Feb 7;40:2.|[3]Li B, et al. Roles of the RANKL-RANK Axis in Immunity-Implications for Pathogenesis and Treatment of Bone Metastasis. Front Immunol. 2022 Mar 21;13:824117.|[4]Tobeiha M, et al. RANKL/RANK/OPG Pathway: A Mechanism Involved in Exercise-Induced Bone Remodeling. Biomed Res Int. 2020 Feb 19;2020:6910312.|[5]Shimamura M, et al. OPG/RANKL/RANK axis is a critical inflammatory signaling system in ischemic brain in mice. Proc Natl Acad Sci U S A. 2014 Jun 3;111 (22) :8191-6.|[6]He X, et al. Resveratrol prevents RANKL-induced osteoclast differentiation of murine osteoclast progenitor RAW 264.7 cells through inhibition of ROS production. Biochem Biophys Res Commun. 2010 Oct 22;401 (3) :356-62.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TADA3L, CT (TADA3, ADA3, TADA3L, Transcriptional adapter 3, ADA3 homolog, STAF54, Transcriptional adapter 3-like) (PE)
MBS6353313-01 0.2 mL

TADA3L, CT (TADA3, ADA3, TADA3L, Transcriptional adapter 3, ADA3 homolog, STAF54, Transcriptional adapter 3-like) (PE)

Ask
View Details
TADA3L, CT (TADA3, ADA3, TADA3L, Transcriptional adapter 3, ADA3 homolog, STAF54, Transcriptional adapter 3-like) (PE)
MBS6353313-02 5x 0.2 mL

TADA3L, CT (TADA3, ADA3, TADA3L, Transcriptional adapter 3, ADA3 homolog, STAF54, Transcriptional adapter 3-like) (PE)

Ask
View Details
Anti-CD11c Antibody Clone ITGAX/1243, Unconjugated-20ug
3687-MSM3-P0 20ug

Anti-CD11c Antibody Clone ITGAX/1243, Unconjugated-20ug

Ask
View Details
GPR174 Polyclonal Antibody
JOT-AP03721-01 50ul

GPR174 Polyclonal Antibody

Ask
View Details
GPR174 Polyclonal Antibody
JOT-AP03721-02 100ul

GPR174 Polyclonal Antibody

Ask
View Details
Recombinant Thermoplasma acidophilum Probable cobyric acid synthase (cobQ)
MBS1423351-01 0.02 mg (E-Coli)

Recombinant Thermoplasma acidophilum Probable cobyric acid synthase (cobQ)

Ask
View Details