CD63, Human/Cynomolgus (HEK293, His)
The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html
Purity
95.0
Smiles
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Molecular Formula
967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)
Molecular Weight
Approximately 18-28 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Box of 100 Folded Very Fast Ashless Filter, 70 Mm
Recombinant Bacillus anthracis Putative membrane protein insertion efficiency factor (BA_5048, GBAA_5048, BAS4688)
Recombinant Bacillus anthracis Putative membrane protein insertion efficiency factor (BA_5048, GBAA_5048, BAS4688)
Recombinant Bacillus anthracis Putative membrane protein insertion efficiency factor (BA_5048, GBAA_5048, BAS4688)
Recombinant Bacillus anthracis Putative membrane protein insertion efficiency factor (BA_5048, GBAA_5048, BAS4688)