Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf90 3'UTR GFP Stable Cell Line
TU053277 1.0 mL

C21orf90 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
INTS3 (NM_023015) Human Tagged Lenti ORF Clone
RC211083L3 10 µg

INTS3 (NM_023015) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal DC-LAMP Antibody (020) [PerCP]
NBP2-89282PCP 0.1 mL

Rabbit Monoclonal DC-LAMP Antibody (020) [PerCP]

Sign In for Pricing
View Details
MS4A13 Protein Vector (Human) (pPB-N-His)
PV101619 500 ng

MS4A13 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PHKA2 (Phosphorylase B Kinase Regulatory Subunit alpha, Liver Isoform, Phosphorylase Kinase alpha L Subunit, PHKLA, PYK, MGC133071) (MaxLight 550)
131267-ML550 100 µL

PHKA2 (Phosphorylase B Kinase Regulatory Subunit alpha, Liver Isoform, Phosphorylase Kinase alpha L Subunit, PHKLA, PYK, MGC133071) (MaxLight 550)

Sign In for Pricing
View Details
PARP2 Knockout Hela Polyclonal Cells
ARG8684 1 Million

PARP2 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details