Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC9A4 (NM_001011552) Human Tagged ORF Clone
RG212529 10 µg

SLC9A4 (NM_001011552) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Integrin beta1 Mouse mAb
MBS476271-01 0.1 mL

Anti-Integrin beta1 Mouse mAb

Sign In for Pricing
View Details
Anti-Integrin beta1 Mouse mAb
MBS476271-02 5x 0.1 mL

Anti-Integrin beta1 Mouse mAb

Sign In for Pricing
View Details
HBXIP (LAMTOR5, Ragulator Complex Protein LAMTOR5, Hepatitis B Virus X-interacting Protein, HBV X-interacting Protein, HBX-interacting Protein, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 5, XIP) (FITC)
127739-FITC 100 µL

HBXIP (LAMTOR5, Ragulator Complex Protein LAMTOR5, Hepatitis B Virus X-interacting Protein, HBV X-interacting Protein, HBX-interacting Protein, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 5, XIP) (FITC)

Sign In for Pricing
View Details
PPP1R1A Protein Vector (Human) (pPB-N-His)
PV032478 500 ng

PPP1R1A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Sdk1 AAV siRNA Pooled Vector
43266164 1.0 µg

Sdk1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details