Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Super Broth No.II, Granulated
GM1689-500G 500 g

Super Broth No.II, Granulated

Sign In for Pricing
View Details
PPRC1, CT (PPRC1, KIAA0595, Peroxisome proliferator-activated receptor gamma coactivator-related protein 1, PGC-1-related coactivator) (Biotin) discontinued
040370-Biotin 200 µL

PPRC1, CT (PPRC1, KIAA0595, Peroxisome proliferator-activated receptor gamma coactivator-related protein 1, PGC-1-related coactivator) (Biotin) discontinued

Sign In for Pricing
View Details
TAMRA-PEG3-biotin
MF-0042856-01 100 mg

TAMRA-PEG3-biotin

Sign In for Pricing
View Details
TAMRA-PEG3-biotin
MF-0042856-02 500 mg

TAMRA-PEG3-biotin

Sign In for Pricing
View Details
AKT1S1 Knockout HT29 Polyclonal Cells
ARG32908 1 Million

AKT1S1 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Human Pentraxin 3/TSG-14 MAb (Clone 247911)
MAB1826-SP 25 µg

Human Pentraxin 3/TSG-14 MAb (Clone 247911)

Sign In for Pricing
View Details