Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DENND4C Protein Vector (Human) (pPM-C-HA)
PV072811 500 ng

DENND4C Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human Siglec-7 (C-6His)
32-11354-10 10 µg

Recombinant Human Siglec-7 (C-6His)

Sign In for Pricing
View Details
Slco1b2 Protein Vector (Mouse) (pPM-C-HA)
PV231488 500 ng

Slco1b2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Kir4.1 (KCNJ10) CytoSection
TS413543P5 25 Slides

Kir4.1 (KCNJ10) CytoSection

Sign In for Pricing
View Details
NEK8 Protein Vector (Rat) (pPM-C-HA)
PV284908 500 ng

NEK8 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Antiviral Compound Library
C06792 100 μL/Well

Antiviral Compound Library

Sign In for Pricing
View Details