Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sall2 shRNA Plasmid (h)
sc-44085-SH 20 µg

Sall2 shRNA Plasmid (h)

Sign In for Pricing
View Details
Human PLCz1 ELISA Kit
E029214 1 Each

Human PLCz1 ELISA Kit

Sign In for Pricing
View Details
Chmp1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6061508 1.0 µg DNA

Chmp1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
V1RA14 Adenovirus (Rat)
49407056 1.0 mL

V1RA14 Adenovirus (Rat)

Sign In for Pricing
View Details
Crem 3'UTR Luciferase Stable Cell Line
TU202787 1.0 mL

Crem 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Glutamate Decarboxylase 2 (GAD2) ELISA Kit
abx151612-01 96 Tests

Human Glutamate Decarboxylase 2 (GAD2) ELISA Kit

Sign In for Pricing
View Details