Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Chicken CD44 Monoclonal Antibody-[APC]
VD7N281 1 Each

Mouse Anti-Chicken CD44 Monoclonal Antibody-[APC]

Sign In for Pricing
View Details
mmu-miR-188-3p miRNA Inhibitor
MIM01292 2x 5.0 nmol

mmu-miR-188-3p miRNA Inhibitor

Sign In for Pricing
View Details
KLF7P1 Protein Vector (Human) (pPM-C-His)
PV089217 500 ng

KLF7P1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GRB10 Antibody
A14208-50UG 50 µg

GRB10 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CROP Antibody [DyLight 594]
NB100-74625DL594 0.1 mL

Rabbit Polyclonal CROP Antibody [DyLight 594]

Sign In for Pricing
View Details
Lentiviral mouse Dmrtc2 shRNA (UAS) - Lentiviral mouse Dmrtc2 shRNA (UAS) plasmid
GTR15169867 1 Vial

Lentiviral mouse Dmrtc2 shRNA (UAS) - Lentiviral mouse Dmrtc2 shRNA (UAS) plasmid

Sign In for Pricing
View Details