Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 (NCAM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]
TA805376BM 100 µL

CD56 (NCAM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details
Mouse Monoclonal IL-15R alpha Antibody (JM7A4) [mFluor Violet 610 SE]
NBP1-43238MFV610 0.1 mL

Mouse Monoclonal IL-15R alpha Antibody (JM7A4) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Human Carboxypeptidase A4 (CPA4) ELISA Kit
RDR-CPA4-Hu-48Tests 48 Tests

Human Carboxypeptidase A4 (CPA4) ELISA Kit

Sign In for Pricing
View Details
NFATC2 (Nuclear Factor Of Activated T-cells, Cytoplasmic 2, NF-ATc2, NFATc2, T-cell Transcription Factor NFAT1, NFAT Pre-existing Subunit, NF-ATp, NFAT1, NFATP) (HRP)
MBS6153768-01 0.1 mL

NFATC2 (Nuclear Factor Of Activated T-cells, Cytoplasmic 2, NF-ATc2, NFATc2, T-cell Transcription Factor NFAT1, NFAT Pre-existing Subunit, NF-ATp, NFAT1, NFATP) (HRP)

Sign In for Pricing
View Details
NFATC2 (Nuclear Factor Of Activated T-cells, Cytoplasmic 2, NF-ATc2, NFATc2, T-cell Transcription Factor NFAT1, NFAT Pre-existing Subunit, NF-ATp, NFAT1, NFATP) (HRP)
MBS6153768-02 5x 0.1 mL

NFATC2 (Nuclear Factor Of Activated T-cells, Cytoplasmic 2, NF-ATc2, NFATc2, T-cell Transcription Factor NFAT1, NFAT Pre-existing Subunit, NF-ATp, NFAT1, NFATP) (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal Sortilin Antibody (334703) [DyLight 488]
FAB31541K 0.1 mL

Mouse Monoclonal Sortilin Antibody (334703) [DyLight 488]

Sign In for Pricing
View Details