Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMYD3 antibody
FNab08049 100 µg

SMYD3 antibody

Sign In for Pricing
View Details
AP2M1 (NM_004068) Human Tagged Lenti ORF Clone
RC218161L1 10 µg

AP2M1 (NM_004068) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human SYCN Knockout HEK293T cell line
GTR15412591 1 Vial

Human SYCN Knockout HEK293T cell line

Sign In for Pricing
View Details
SELP AAV Vector (Rat) (CMV)
43336106 1 µg

SELP AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
ACKR3 Polyclonal Antibody, APC-Cy7 Conjugated
bs-4897R-APC-Cy7 100 µL

ACKR3 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
C9orf37 3'UTR Luciferase Stable Cell Line
TU002577 1.0 mL

C9orf37 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details