Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Rat Anti-KLH IgG (Keyhole Limpet Hemocyanin IgG) ELISA
KLR2613 1x 96 Well

GENLISA Rat Anti-KLH IgG (Keyhole Limpet Hemocyanin IgG) ELISA

Sign In for Pricing
View Details
Rabbit Monoclonal 5'-Nucleotidase/CD73 Antibody (102) [Allophycocyanin]
NBP2-89706APC 0.1 mL

Rabbit Monoclonal 5'-Nucleotidase/CD73 Antibody (102) [Allophycocyanin]

Sign In for Pricing
View Details
Phospho-A-RAF (Ser299) Peptide
AF8132-BP 1 mg

Phospho-A-RAF (Ser299) Peptide

Sign In for Pricing
View Details
Pds5b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4979008 1.0 µg DNA

Pds5b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
EthD-III
HY-D1723-01 100 µg

EthD-III

Sign In for Pricing
View Details
EthD-III
HY-D1723-02 250 µg

EthD-III

Sign In for Pricing
View Details