Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin Alpha-4 (CD49d) Antibody (RPE)
abx415652 25 Tests

Integrin Alpha-4 (CD49d) Antibody (RPE)

Sign In for Pricing
View Details
p38 MAPK Rabbit pAb
A11340 500 µL

p38 MAPK Rabbit pAb

Sign In for Pricing
View Details
Rabbit Monoclonal CD28 Antibody (D665) [DyLight 594]
NBP2-81054DL594 0.1 mL

Rabbit Monoclonal CD28 Antibody (D665) [DyLight 594]

Sign In for Pricing
View Details
Fc receptor-like protein 1 (FCRL1) Antibody
abx347172 0.1 mg

Fc receptor-like protein 1 (FCRL1) Antibody

Sign In for Pricing
View Details
Eno1b (NM_001025388) Mouse Tagged ORF Clone Lentiviral Particle
MR206927L3V 200 µL

Eno1b (NM_001025388) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CLK2 Protein Vector (Rat) (pPM-C-His)
PV260525 500 ng

CLK2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details