Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Skin
CS502257 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
PTK9 Polyclonal Antibody, Cy5.5 Conjugated
bs-4169R-Cy5.5 100 µL

PTK9 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
JUN Knockout 786-O Polyclonal Cells
ARG35186 1 Million

JUN Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
mIgG (98-330) Mouse Protein
AR50337PU-N 250 µg

mIgG (98-330) Mouse Protein

Sign In for Pricing
View Details
RAD51C (NM_002876) Human Tagged Lenti ORF Clone
RC217860L4 10 µg

RAD51C (NM_002876) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mllt3 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6960202 1.0 µg DNA

Mllt3 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details