Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal KLF13 Antibody [Alexa Fluor 488]
NBP2-98809AF488 0.1 mL

Rabbit Polyclonal KLF13 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Native Goat IgG
PPT-16804 100 µg

Native Goat IgG

Sign In for Pricing
View Details
ETFRF1 Antibody
A58722-50UG 50 µg

ETFRF1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Soft tissue
CB628072 1 Block

Frozen Tissue Blocks, Soft tissue

Sign In for Pricing
View Details
HER2 Antibody / ErbB2
V7735-100UG 100 µg

HER2 Antibody / ErbB2

Sign In for Pricing
View Details
GTF2F1 antibody
10R-4278 100 ul

GTF2F1 antibody

Sign In for Pricing
View Details