Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN3A3 siRNA (h)
Tue Dec 31 95624 23:00:00 GMT+0000 (Coordinated Universal Time) 10 µM

BTN3A3 siRNA (h)

Sign In for Pricing
View Details
Recombinant Human MMP9 Protein, N-His
YHD06801-01 100 µg

Recombinant Human MMP9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MMP9 Protein, N-His
YHD06801-02 1 mg

Recombinant Human MMP9 Protein, N-His

Sign In for Pricing
View Details
Trichomonas vaginalis (FITC)
227206-FITC 100 µL

Trichomonas vaginalis (FITC)

Sign In for Pricing
View Details
Lentiviral human CR1L sgRNA gene knockout kit - Lentiviral human CR1L sgRNA gene knockout kit (plasmid)
GTR15360140 1 Vial

Lentiviral human CR1L sgRNA gene knockout kit - Lentiviral human CR1L sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human FAH (Fumarylacetoacetate Hydrolase) ELISA Kit
EH24427 96 Tests

Human FAH (Fumarylacetoacetate Hydrolase) ELISA Kit

Sign In for Pricing
View Details