Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tceal7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3614805 3x 1.0 µg

Tceal7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
APC Anti-Mouse CD326 Antibody
RD21996F-01 50 Tests

APC Anti-Mouse CD326 Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD326 Antibody
RD21996F-02 100 Tests

APC Anti-Mouse CD326 Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD326 Antibody
RD21996F-03 2x 100 Tests

APC Anti-Mouse CD326 Antibody

Sign In for Pricing
View Details
ICK sgRNA CRISPR Lentivector (Human) (Target 1)
K1011202 1.0 µg DNA

ICK sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Epithelial Cell Adhesion Molecule (EPCAM)
MBS2108603-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Epithelial Cell Adhesion Molecule (EPCAM)

Sign In for Pricing
View Details