Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r109 3'UTR GFP Stable Cell Line
TU171996 1.0 mL

Vmn2r109 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human Olfactory receptor 8D2 (OR8D2) ELISA Kit
abx537135 96 Tests

Human Olfactory receptor 8D2 (OR8D2) ELISA Kit

Sign In for Pricing
View Details
GLRX3 Protein Vector (Human) (pPB-C-His)
PV017805 500 ng

GLRX3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) shi Polyclonal Antibody
MBS7153941 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) shi Polyclonal Antibody

Sign In for Pricing
View Details
PDCD6 (NM_013232) Human Tagged Lenti ORF Clone
RC202030L4 10 µg

PDCD6 (NM_013232) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Tbc1d10b shRNA (UAS) - Lentiviral mouse Tbc1d10b shRNA (UAS, RFP) (100)
GTR15250668 1 Vial

Lentiviral mouse Tbc1d10b shRNA (UAS) - Lentiviral mouse Tbc1d10b shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details