Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem92 (NM_001034896) Mouse Tagged ORF Clone
MR221816 10 µg

Tmem92 (NM_001034896) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human LIGHT / TNF Superfamily Member 14, Animal Free & Carrier Free
C-CYP234-1mg 1 mg

Recombinant Human LIGHT / TNF Superfamily Member 14, Animal Free & Carrier Free

Sign In for Pricing
View Details
LCE4A (NM_178356) Human Tagged Lenti ORF Clone
RC223389L4 10 µg

LCE4A (NM_178356) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SNRPE (FITC)
577348-01 50 µg

SNRPE (FITC)

Sign In for Pricing
View Details
SNRPE (FITC)
577348-02 100 µg

SNRPE (FITC)

Sign In for Pricing
View Details
Aloisine A RP107
TRC-A575450-5MG 5 mg

Aloisine A RP107

Sign In for Pricing
View Details