CD63, Human/Cynomolgus (HEK293, His)
The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html
Purity
95.0
Smiles
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Molecular Formula
967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)
Molecular Weight
Approximately 18-28 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Recombinant Human Histone H2B type 1-B Protein, His-SUMO, E.coli-500ug
Rabbit Polyclonal Sars Membrane Protein Antibody [Alexa Fluor 350]
Lentiviral human GM2A sgRNA gene knockout kit - Lentiviral human GM2A sgRNA gene knockout kit (25)
Anti-CD8A (Cytotoxic / Suppressor T-Cell Marker) Monoclonal Antibody (Clone: RIV11)
