Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Human/Cynomolgus (HEK293, His)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Human/Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD63 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Human/Cynomolgus (HEK293, His), Cynomolgus; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Formula

967/709828 (Gene_ID) P08962-1/NP_001253224 (A103-V203) (Accession)

Molecular Weight

Approximately 18-28 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gm3500 shRNA (UAS) - Lentiviral mouse Gm3500 shRNA (UAS, iRFP) (100)
GTR15234435 1 Vial

Lentiviral mouse Gm3500 shRNA (UAS) - Lentiviral mouse Gm3500 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
GPR142 Rabbit Polyclonal Antibody
TA368438 100 µL

GPR142 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPPDE1 (C1orf121, CGI-146, FAM152A, Family with Sequence Similarity 152, Member A, FLJ21998, PNAS-4, PPPDE Peptidase Domain Containing 1, PNAS4)
208366 100 µg

PPPDE1 (C1orf121, CGI-146, FAM152A, Family with Sequence Similarity 152, Member A, FLJ21998, PNAS-4, PPPDE Peptidase Domain Containing 1, PNAS4)

Sign In for Pricing
View Details
C 87 25mg
A12313-25 25 mg

C 87 25mg

Sign In for Pricing
View Details
NSUN5 Recombinant Protein Antigen
NBP2-58249PEP 100 µL

NSUN5 Recombinant Protein Antigen

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) TRPB Polyclonal Antibody
MBS9002008 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) TRPB Polyclonal Antibody

Sign In for Pricing
View Details