Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucagon receptor (GCGR), partial (Active)

Product Specifications

Product Name Alternative

GL-R

Abbreviation

Recombinant Human GCGR protein, partial (Active)

Gene Name

GCGR

UniProt

P47871

Expression Region

26-136aa

Organism

Homo sapiens (Human)

Target Sequence

AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody (CSB-RA009316A1HU), the EC50 is 3.747-6.666 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.1 kDa

References & Citations

"Conformational dimorphism of self-peptides and molecular mimicry in a disease-associated HLA-B27 subtype." Ruckert C., Fiorillo M.T., Loll B., Moretti R., Biesiadka J., Saenger W., Ziegler A., Sorrentino R., Uchanska-Ziegler B. J. Biol. Chem. 281:2306-2316 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chmp2b (NM_026879) Mouse Tagged ORF Clone
MG202330 10 µg

Chmp2b (NM_026879) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ITK Mouse Monoclonal Antibody [Clone ID: 5G6]
AM06655SU-N 100 µL

ITK Mouse Monoclonal Antibody [Clone ID: 5G6]

Sign In for Pricing
View Details
CD5L Polyclonal Antibody
E-AB-16326-01 20 µL

CD5L Polyclonal Antibody

Sign In for Pricing
View Details
CD5L Polyclonal Antibody
E-AB-16326-02 60 µL

CD5L Polyclonal Antibody

Sign In for Pricing
View Details
CD5L Polyclonal Antibody
E-AB-16326-03 120 µL

CD5L Polyclonal Antibody

Sign In for Pricing
View Details
CD5L Polyclonal Antibody
E-AB-16326-04 200 µL

CD5L Polyclonal Antibody

Sign In for Pricing
View Details