Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frizzled-7, Human (HEK293, His)

Frizzled-7 (FZD7) is a Wnt receptor that primarily activates the β-catenin classical pathway, involving Disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Some family members exhibit a second PKC and calcium flux signaling pathway, but the integration is unclear. Frizzled-7/FZD7 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-7/FZD7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Frizzled-7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frizzled-7-fzd7-protein-human-his.html

Purity

95.00

Smiles

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Molecular Formula

8324 (Gene_ID) O75084 (Q33-L185) (Accession)

Molecular Weight

Approximately 23-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP5 Antibody - middle region
ARP54712_P050-25UL 25 µL

FKBP5 Antibody - middle region

Sign In for Pricing
View Details
LYRM1 Antibody
5659-01mg 0.1 mg

LYRM1 Antibody

Sign In for Pricing
View Details
6330403K07Rik Protein Vector (Mouse) (pPM-C-His)
PV150133 500 ng

6330403K07Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to Inhibin Beta A (INHbA)
MBS2131564-01 0.1 mL

HRP Linked Monoclonal Antibody to Inhibin Beta A (INHbA)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to Inhibin Beta A (INHbA)
MBS2131564-02 0.2 mL

HRP Linked Monoclonal Antibody to Inhibin Beta A (INHbA)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to Inhibin Beta A (INHbA)
MBS2131564-03 0.5 mL

HRP Linked Monoclonal Antibody to Inhibin Beta A (INHbA)

Sign In for Pricing
View Details