Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Left-right determination factor 2 (Lefty2)

Product Specifications

Product Name Alternative

Left-right determination factor B (Protein lefty-2) (Protein lefty-B) (Leftb)

Abbreviation

Recombinant Mouse Lefty2 protein

Gene Name

Lefty2

UniProt

P57785

Expression Region

78-368aa

Organism

Mus musculus (Mouse)

Target Sequence

FSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRGIDL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Required for left-right asymmetry determination of organ systems in mammals.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.1 kDa

References & Citations

"The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y. Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SLC22A12 Antibody
NBP1-82500-25ul 25 µL

Rabbit Polyclonal SLC22A12 Antibody

Sign In for Pricing
View Details
ANXA7
CSB-CL001848HU 10 μg Plasmid + 200 μL Glycerol

ANXA7

Sign In for Pricing
View Details
RECORD indicators +29°C, VE=50
1216193 50 PK

RECORD indicators +29°C, VE=50

Sign In for Pricing
View Details
Recombinant Mouse Transmembrane 4 L6 family member 1 (Tm4sf1) -VLPs
orb2986863-01 20 µg

Recombinant Mouse Transmembrane 4 L6 family member 1 (Tm4sf1) -VLPs

Sign In for Pricing
View Details
Recombinant Mouse Transmembrane 4 L6 family member 1 (Tm4sf1) -VLPs
orb2986863-02 100 µg

Recombinant Mouse Transmembrane 4 L6 family member 1 (Tm4sf1) -VLPs

Sign In for Pricing
View Details
Recombinant Mouse Transmembrane 4 L6 family member 1 (Tm4sf1) -VLPs
orb2986863-03 1 mg

Recombinant Mouse Transmembrane 4 L6 family member 1 (Tm4sf1) -VLPs

Sign In for Pricing
View Details